PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0094s0030.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 281aa    MW: 30757.3 Da    PI: 9.1874
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0094s0030.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91.1e-383797262
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            ke+a++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lr +PvGgg+rknk+ss
  SapurV1A.0094s0030.2.p 37 KEQAINCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRSIPVGGGSRKNKRSS 97
                            7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-273089IPR003851Zinc finger, Dof-type
PfamPF027015.7E-333995IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6584195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPIEEIVA NTCSKPPASK RKARPQKEQA INCPRCNSTN TKFCYYNNYS  60
LTQPRYFCKT CRRYWTEGGS LRSIPVGGGS RKNKRSSASS SSKKLPNLIS PPALSQTSTE  120
NHRIHEGQDL NLAFPGTQGI RSFTELIQFP SINESNNKTP IASSTSASNN TSQLSALELL  180
TGISSRGLNS FPMPVHQDPS TLYTSGFPLQ DFKQTLSFSL DGLGSGYGSL QGVRETNGRL  240
LFPFEDLKQQ VSSTADIEQQ NKEHGDSTGY WTGMLGGGSW *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011026820.11e-178PREDICTED: dof zinc finger protein DOF4.6 isoform X1
SwissprotQ8LAP82e-72DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLB9GXU91e-166B9GXU9_POPTR; Uncharacterized protein
STRINGPOPTR_0003s14450.11e-166(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.13e-62Dof family protein